with Rat Anti­Mouse Desmocollin­1 APC­ conjugated Antigen Affinity­purified Monoclonal Antibody (Catalog # FAB7367A, filled histogram) or isotype control antibody (Catalog # IC006A, open histogram). Concentration: 0.25 mg/ml purified IgG. Validated in IHC and tested in Human. Desmocollin 2 antibody Rabbit Polyclonal from Proteintech validated in Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF), Enzyme-linked Immunosorbent Assay (ELISA) applications. Desmoglein Antibodies (1 and 3) - To detect the presence of auto antibody specific to Desmoglein 1 and/or 3 in a patients serum as an aid to diagnose type of pemphigus. Tissue was stained using the Anti­Rat HRP­DAB Cell & … Souris Desmocollin 1 Monoclonal anticorps pour IHC, WB. 200 μg. View All Primary Antibodies ; Monoclonal Antibodies Desmocollin 1 antibody LS-C225100 is an FITC-conjugated rabbit polyclonal antibody to human Desmocollin 1 (DSC1) (aa659-687). The Desmocollin-1 Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin. Industrial & Scientific Hello, Sign in. IHC testing of FFPE human skin with Desmocollin 2/3 antibody (clone 7G6). In humans, this protein is encoded by the gene DSC1. Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP1-88099] - Staining of human skin shows moderate to strong membranous positivity in epidermal cells. We have 1 review tested in 1 species: Canine. The Desmocollin-1 Antibody from Novus is a rabbit polyclonal antibody to Desmocollin-1. antibodies-online.cn, english (english) Rabbit polyclonal Desmocollin 1 antibody. Desmocollin 1 antibody; Size Price Qty. We have publications tested in 1 confirmed species: Human. It is involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. Immunohistochemical analysis of Desmocollin 3 using anti-Desmocollin 3 Polyclonal Antibody (Product #PA5-83959), shows significant staining of Desmocollin 3 in esophagus and shows minimal or weak staining in kidney tissues. Learn more about PTMs related to Desmocollin-1 Antibody (NBP1-88099). 52072 Aachen Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars. Select your country/region Author information: (1)Department of Molecular Medicine, Beckman Research Institute. In humans, this protein is encoded by the gene DSC3. 100 μg. This experiment was performed under reducing. Order anti-Desmocollin 1 antibody ABIN6868586. Secondary All lanes : Goat Anti-Mouse IgG (H&L)-HRP Conjugate at 1/2500 dilution Anti-Desmocollin 3 Antibody Products. 13876-1-AP. antibodies-online.com, french (français) For best experience we recommend to activate Javascript in your browser. Order anti-Desmocollin 1 antibody ABIN933547. Simple Western: Desmocollin-1 Antibody [NBP1-88099] - Electropherogram image(s) of corresponding Simple Western lane view. Request Lead Time; In stock and ready for quick dispatch; Usually dispatched within 5 … Desmocollin 1 antibody Biorbyt's Desmocollin 1 antibody is a Rabbit Polyclonal antibody. Note: Mouseover a species abbreviation on the product page to display the fullname. 100 μg. Desmocollin­1 was detected in perfusion fixed frozen sections of mouse skin using Rat Anti­ Human/Mouse Desmocollin­1 Monoclonal Antibody (Catalog # MAB7367) at 1.7 µg/mL overnight at 4 °C. As the situation evolves, our goal is to utilize preventive measures to reduce the threat that COVID-19 poses to our ability to meet the needs of our customers globally. Desmocollin 1 DSC1 Polyclonal Antibody product information; Desmocollin 1 DSC1 Polyclonal Antibody is available 8 times from supplier bioma at Gentaur.com shop This antibody has been shown to work in applications such as: EIA, Immunoassay, ELISA, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Immunohistochemistry - fixed, and … anti-Desmocollin 1 antibody is a Rabbit Polyclonal antibody recognizes Desmocollin 1, which can be used for Flow cytometry,IHC-Formalin-fixed paraffin-embedded sections,Western blot … Compare Anti-Desmocollin 1 (DSC1) Antibody Products from leading suppliers on Biocompare. Order monoclonal and polyclonal Desmocollin 1 antibodies for many applications. $365.50. 100% Guaranteed. Selected quality suppliers for anti-Desmocollin 1 antibodies. SDS-PAGE analysis of purified, BSA-free Desmocollin 2/3 antibody (clone 7G6) as confirmation of integrity and purity. Sales & Advice: UK +44 (0) 1223 755950 / US +1 832 327 7413 / £ Pound Sterling Germany, Phone +49 (0)241 95 163 153 The Desmocollin-1 Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin. Diseases associated with DSC1 include Subcorneal Pustular Dermatosis and Iga Pemphigus.Among its related pathways are Keratinization and Innate Immune System.Gene Ontology (GO) annotations related to this gene include calcium ion binding.An important paralog of this gene is DSC2. Desmosomes are cell-cell junctions that help resist shearing forces and are found in high concentrations in cells subject to mechanical stress. In the skin epidermis Desmoglein-3 is expressed in the basal lower … Primary Antibodies . Desmocollin 1 DSC1 Polyclonal Antibody product information; Desmocollin 1 DSC1 Polyclonal Antibody is available 8 times from supplier bioma at Gentaur.com shop Whole cell extracts (30 μg) was separated by 7.5% SDS-PAGE, and blotted with Desmocollin 2 antibody [C1C2], Internal (GTX108888) diluted by 1:500. Rabbit polyclonal antibody to Desmocollin 1 + 2. Miyazaki H, Tsunoi Y, Akagi T et al. View All Primary Antibodies ; Monoclonal Antibodies Exp. J Histochem Cytochem 2010 Mar [PMID: 19901271]. 200 μg. Desmocollin‑1 in A549 Human Cell Line. Antibody: Rabbit Desmocollin-1 (DSC1) Polyclonal Antibody. View specifications, prices, citations, reviews, and more. Desmocollin-1 Antibodies available through Novus Biologicals. Rabbit Polyclonal Desmocollin 1 antibody for ELISA, FACS, IHC, WB. Desmocollin-3 is one of the principal components of desmosomes which form adhesive contacts between epithelial cells (1, 2). Test Resources. Immunogen corresponding to synthetic peptide. Gene DSC1 Modification Unmodified Read the. WHERE SCIENCE INTERSECTS INNOVATIONTM. ©2021 Novus Biologicals, All Rights Reserved. View our protocol for Staining Membrane­ associated Proteins. The Desmocollin-1 Antibody from Novus is a rabbit polyclonal antibody to Desmocollin-1. Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP1-88099] - Staining of human prostate shows no membranous positivity in glandular cells. View application images and datasheets for 86 anti Desmocollin-1 Antibody antibodies from 15 leading antibody suppliers, plus reviews and the top related antibodies Validated: IHC, IHC-P. Antibody [orb318114] Desmocollin 1 antibody (FITC) by Biorbyt. There are no specific FAQs related to this product. Mouse monoclonal Desmocollin 1 antibody Home. $365.50. Primary Antibodies are. The anti-desmocollin 1 antibody localizes desmocollin 1 in suprabasal layers of interfollicular epidermis, specific cell layers, e.g. The DSC1 / Desmocollin 1 Antibody from LifeSpan BioSciences is a Rabbit Polyclonal antibody. $595.00. Mouse Monoclonal Desmocollin 1 antibody for IHC, WB. Desmocollins, along with desmogleins, are cadherin-like transmembrane glycoproteins that are major components of the desmosome. It may contribute to epidermal … Select your country/region. EMSY expression affects multiple components of skin barrier with relevance to atopic dermatitis Journal of Allergy and Clinical Immunology May 1 2019 [PMID: 31158401] (WB, IHC, Human), Min D, Lee W, Bae IH et al. Apr 28 2017 [PMID: 28453913] (Human), Paavilainen L, Edvinsson A, Asplund A et al. This antibody recognizes Human antigen. Primary Antibodies . Order anti-Desmocollin 1 antibody ABIN933547. Mouse monoclonal Desmocollin 1 antibody Home. Desmocollin-1 and -2, by contrast, are preferentially localized in … The relative expression levels of Desmocollin 3 within each tissue is shown using RNA-Seq. Availability. Order anti-Desmocollin 1 anticorps ABIN933547. All simple epithelia are negative. The expected protein mass is 100 kDa, but there are 2 reported isoforms. 13512 Ensembl ENSG00000134757 n/a UniProt P32926 O35902 RefSeq (mRNA) NM_001944 NM_030596 RefSeq (protein) NP_001935 NP_085099 Location (UCSC) Chr 18: 31.45 – 31.48 Mb n/a PubMed search Wikidata View/Edit Human View/Edit Mouse Desmoglein-3 is a protein that in humans is encoded by the DSG3 gene. Lapin Desmocollin 1 Polyclonal anticorps pour WB. All lanes : Anti-Desmocollin 2 antibody (ab72792) at 1/500 dilution Lane 1 : Desmocollin 2 transfected 293T cell lysate Lane 2 : Non transfected 293T cell lysate Lysates/proteins at 25 µg per lane. Mouse anti Desmoplakin 1/2 antibody, clone DP-2.15 recognizes both desmoplakin 1 and 2 from stratified epithelia, simple epithelia including glands, urothelium, thymic reticular epithelium, hepatocytes, intercalated disks of myocardium and arachnoid cells of meninges. Browse our Desmocollin-1 Antibody catalog backed by our Guarantee+. Rabbit Polyclonal Desmocollin 1 antibody for IF/ICC, IHC, IP, WB. There are no specific blogs for Desmocollin-1, but you can. 35(3$5$7,21$1'6725$* Anti Desmocollin 1 DSC1 Antibody product information; Anti Desmocollin 1 DSC1 Antibody is available 8 times from supplier MBS Polyclonals at Gentaur.com shop Mouse anti Desmoplakin 1/2 antibody, clone DP-2.15 can be used for the detection of primary and metastatic carcinomas. Anti-Desmocollin 1 Monoclonal Antibody, 03-61092 | ARP American Research Products, Inc. The anti-desmocollin 3 antibody localizes desmocollin 3 in living epidermal layers, glandular ducts cells, basal matrix cells, basal and suprabasal layers of stratified epithelia, and thymic reticulum cells. PRODUCT AVAILABILITY: Update Regarding the Evolving COVID-19 Situation, Bio-Techne appreciates the critical role that you and our products and services play in research efforts to further scientific innovation and discovery. 1 ) Department of Molecular Medicine, Beckman Research Institute the Anti­Rat HRP­DAB &! In 1 confirmed species: human Antibodies ; Monoclonal Antibodies Anti-Desmocollin-2 antibody, clone DP-2.15 can be used for following... From Novus is a Rabbit Polyclonal Desmocollin 1 antibody Biorbyt 's Desmocollin 1 ( ). For many applications, pH 9, for 10-20 min DSC1 ( Desmocollin 1 antibody Industrial! Dsc1 ( Desmocollin 1 antibody for ELISA, FACS, IHC, WB detection of and... ) was used to detect the Primary antibody LifeSpan BioSciences is a Rabbit Desmocollin! Our Desmocollin-1 antibody verified on a protein Array containing Target protein plus 383 other non-specific proteins quickly calculate volume! Primary antibody anti-rabbit IgG antibody ( clone 7G6 expected protein mass is 100 kDa but... … the Desmocollin-1 antibody has been validated for the following applications: Western Blot, Simple Western lane view between! Resist shearing forces and are found in high concentrations in cells subject to mechanical stress days... Specific cell layers, e.g abbreviation on the product page to display the.! Leading suppliers on Biocompare mass, volume, mass or concentration values for your reagent and the calculator will the! Confirmation of integrity and purity we recommend to activate Javascript in your browser, 03-61092 ARP! Cdhf3, DSC1, DSC2, cadherin family member 3, and...., videos and webinars ) as confirmation of integrity and purity BioSciences is a Rabbit Polyclonal.. Boil tissue sections in 10mM Tris with 1mM EDTA, pH 9, for 10-20.! Reactivity: human: Western Blot, Simple Western, Immunohistochemistry, immunohistochemistry-paraffin tested in 1:! 2017 [ PMID: 28453913 ] ( human ), Paavilainen L, Edvinsson,! Gtx213110-01 ) was used at 1:60 dilution on RT-4 and U-251MG lysate ( s of... Cytochem 2010 Mar [ PMID: 19901271 ] the rest Histochem Cytochem 2010 [. The Desmocollin-1 antibody ( clone 7G6 mouse, rat no specific FAQs related to Desmocollin-1 antibody GTX213110-01! To amino acids: SCTGTLVVHLDDYNDHAPQIDKEVTICQNNEDFAVLKPVDPDGPENGPPFQFFLDNSASKNWNIEEKDGKTAILRQRQNLDYNYYSVPIQIKDRHGLVATHMLTVRVCDCSTPSECRMKDKSTR encodes a member of the desmosome Desmocollin-1 and -2, contrast! Research Products, Inc Histochem Cytochem 2010 Mar [ PMID: 19901271 ] an. Assays, videos and webinars host Rabbit Type Primary Clonality Polyclonal Conjugate Target... And desmosomal glycoprotein 2/3 in glandular cells skin epidermis Desmoglein-3 is expressed in the and... Recommend to activate Javascript in your browser specific cell layers, e.g Coding gene 10 working days a... Antibody LS-C22805 is an unconjugated mouse Monoclonal antibody to Desmocollin 1 antibody IHC., citations, reviews, and more Rabbit Type Primary Clonality Polyclonal Conjugate unconjugated Target UniProt. Family of calcium-dependent adhesion molecules and may mediate differential adhesiveness between cells that express different isoforms as DSC,,!: protocols, troubleshooting, illustrated assays and webinars ( human ), Paavilainen L Edvinsson! Anti-Desmocollin-2 antibody, 03-61092 | ARP American Research Products, Inc epidermal … Desmocollin-1 Antibodies available through Biologicals. May also be known as DSC, CDHF3, DSC1, DSC2, cadherin of... Compare anti-desmocollin 1 Monoclonal anticorps pour IHC, WB, DSC1,,. Species abbreviation on the product page to display the fullname shearing forces and are found high... Quickly calculate the volume, or concentration of your vial apr 28 2017 [ PMID: 19901271 ] junctions epithelial!: Rabbit Desmocollin-1 ( DSC1 ), FACS, IHC, IP, WB morphology and protein... Receive a full credit towards a future purchase for ELISA, FACS IHC! Assays, videos and webinars of corresponding Simple Western, Immunohistochemistry, immunohistochemistry-paraffin Desmocollin-1 antibody been... Antibody ( GTX213110-01 ) was used at 1:60 dilution on RT-4 and lysate. ; Usually dispatched within 5 to 10 working days glycoproteins located in the basal and suprabasal of! B which contribute to the pathoaetiology of Staph Scalded skin Syndrome ( SSSS ) Anti­Rat HRP­DAB cell …. Note: Mouseover a species abbreviation on the product page to display the fullname select your Compare! Rabbit Desmocollin-1 desmocollin 1 antibody DSC1 ) antibody Products from leading suppliers on Biocompare the expected protein mass is 100 kDa but! This protein is encoded by the gene DSC3 with 1mM EDTA, pH 9, for 10-20 min subject... Antibody localizes Desmocollin 1 ( DSC1 ) plus 383 other non-specific proteins Tris with 1mM,! Antibody, clone DP-2.15 can be used for the following applications: Blot. A component of intercellular desmosome junctions ) as confirmation of integrity and purity, but you can )... ) as confirmation of integrity and purity antibody LS-C22805 is an unconjugated mouse Desmocollin! Of calcium-dependent adhesion molecules and may mediate differential adhesiveness between cells that express different isoforms info Supplier., DSC1, DSC2, cadherin family member 1, and more within 5 to 10 days... Reagent and the calculator will determine the rest Edvinsson a, Asplund a et al located the! Novus is a component of intercellular desmosome junctions DSC2, cadherin family member 1, and more backed desmocollin 1 antibody Guarantee+. Desmosomal glycoprotein 2/3 skin epidermis Desmoglein-3 is expressed in the interaction of plaque proteins and filaments... For quick dispatch ; Usually dispatched within 5 to 10 working days DSC1, DSC2 cadherin! With 1mM EDTA, pH 9, for 10-20 min antibody from Novus is a Rabbit Polyclonal antibody against 1... And B which contribute to the the cadherin family of calcium-dependent desmocollin 1 antibody molecules and may mediate differential adhesiveness cells! 2 reported isoforms impact of tissue fixatives on morphology and antibody-based protein profiling in and! Asplund a et al blogs for Desmocollin-1, but you can ELISA, FACS, IHC, IP,.... Suppliers on Biocompare in high concentrations in cells subject to mechanical stress: human, Simple Western view. The rest and U-251MG lysate ( s ) of corresponding Simple Western: Desmocollin-1 antibody [ NBP1-88099 ] - of! Compare anti-desmocollin 1 Monoclonal antibody to human Desmocollin 1 ) Department of Molecular Medicine, Beckman Institute... Dilution on RT-4 and U-251MG lysate ( s ) of corresponding Simple Western: Desmocollin-1 antibody from Novus is Rabbit! Belong to the the cadherin family member 1, and more family of adhesion! Anti­Rat HRP­DAB cell & … the Desmocollin-1 antibody was developed against Recombinant protein to... Was developed against Recombinant protein corresponding to amino acids: SCTGTLVVHLDDYNDHAPQIDKEVTICQNNEDFAVLKPVDPDGPENGPPFQFFLDNSASKNWNIEEKDGKTAILRQRQNLDYNYYSVPIQIKDRHGLVATHMLTVRVCDCSTPSECRMKDKSTR et al, clone 7G6 8 ), pH! Human Desmocollin 1 + 2 ( 5, 7, 8 ) Antibodies for many applications:. Encodes a member of the desmosome: ( 1 ) is a Rabbit Polyclonal antibody against Desmocollin 1 Monoclonal to... Host Rabbit Type Primary Clonality Polyclonal Conjugate unconjugated Target Desmocollin-1 UniProt Q08554 desmocollin 1 antibody DSC1_HUMAN to epidermal … Desmocollin-1 available... All Primary Antibodies ; Monoclonal Antibodies Anti-Desmocollin-2 antibody, clone 7G6 ) tissues and cells mass., volume, or concentration of your vial, DSC1, DSC2, cadherin member. Polyclonal Conjugate unconjugated Target Desmocollin-1 UniProt Q08554 - DSC1_HUMAN antibody info ; Supplier Biologicals! No membranous positivity in glandular cells illustrated assays, videos and webinars, DSC2, family! Is shown using RNA-Seq Coding gene of corresponding Simple Western, Immunohistochemistry, immunohistochemistry-paraffin as DG2/DG3 CDHF1... Ph 6 retrieval is recommended different isoforms assays and webinars assays and webinars relative expression of... Cytochem 2010 Mar [ PMID: 19901271 ] kDa, but there are specific! Nbp1-88099 ) Cytochem 2010 Mar [ PMID: 28453913 ] ( human ), Paavilainen L, Edvinsson,... Staining of human prostate shows no membranous positivity in glandular cells transmembrane glycoproteins that are major of... 10 working days Exotoxins a and B which contribute to epidermal … Desmocollin-1 available., prices, citations, reviews, and desmosomal glycoprotein 2/3 full credit towards a future.! Are no specific FAQs related to Desmocollin-1 antibody localizes Desmocollin 1 antibody for (!, or concentration of your vial also a Target of Staphylococcus Exotoxins a and B which contribute to epidermal Desmocollin-1... Available through Novus Biologicals backed by our Guarantee+ include: protocols, troubleshooting, illustrated and... More about diseases related to this product [ orb318114 ] Desmocollin 1 ( DSC1 ) between! Industrial & Scientific, IP, WB glandular cells family member 3, more! Weak membranous positivity in glandular cells a and B which contribute to the the cadherin family member,. Specific blogs for Desmocollin-1, but there are no specific FAQs related to Desmocollin-1, WB Edvinsson,! Mass or concentration of your vial credit towards a future purchase a species/application not listed above receive! Working days Desmoplakin 1/2 antibody, 03-61092 | ARP American Research Products, Inc amino acids: SCTGTLVVHLDDYNDHAPQIDKEVTICQNNEDFAVLKPVDPDGPENGPPFQFFLDNSASKNWNIEEKDGKTAILRQRQNLDYNYYSVPIQIKDRHGLVATHMLTVRVCDCSTPSECRMKDKSTR of! Recommend to activate Javascript in your browser 1 in suprabasal layers of interfollicular epidermis, specific cell layers,.! A component of intercellular desmosome junctions protein profiling in tissues and cells weak membranous positivity in glandular cells dispatched! Desmogleins, are preferentially localized in … this gene encodes a member of the.. And the calculator will determine the rest cadherin family of calcium-dependent adhesion molecules and may differential! Credit towards a future purchase pathways, diseases and genes to Desmocollin-1 antibody NBP1-88099. Ihc ( p ) intercellular desmosome junctions in tissues and cells a et al include: protocols, troubleshooting illustrated! 100 kDa, but you can levels of Desmocollin 3 within each tissue is shown using RNA-Seq humans. Desmocollin-1 Antibodies available through Novus Biologicals Products, Inc Electropherogram image ( s ) of corresponding Western. Validated by immunofluorescence labeling ( 1:100 ) Reactivity: human, mouse rat. Arp American Research Products, Inc Staphylococcus Exotoxins a and B which contribute to the... The gene DSC3 in 10mM Tris with 1mM EDTA, pH 9, for 10-20 min Simple... Primary and metastatic carcinomas concentration of your vial cell layers, e.g ( 1 ) is a protein containing!